Protein Info for Atu1496 in Agrobacterium fabrum C58

Annotation: methionyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00133: tRNA-synt_1" amino acids 3 to 61 (59 residues), 33.6 bits, see alignment 5e-12 amino acids 226 to 338 (113 residues), 48.1 bits, see alignment E=2e-16 TIGR00398: methionine--tRNA ligase" amino acids 7 to 486 (480 residues), 509.5 bits, see alignment E=5.5e-157 PF09334: tRNA-synt_1g" amino acids 8 to 365 (358 residues), 376.9 bits, see alignment E=2.7e-116 PF19303: Anticodon_3" amino acids 377 to 509 (133 residues), 42.2 bits, see alignment E=2e-14

Best Hits

Swiss-Prot: 100% identical to SYM_AGRFC: Methionine--tRNA ligase (metG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 100% identity to atu:Atu1496)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFA2 at UniProt or InterPro

Protein Sequence (516 amino acids)

>Atu1496 methionyl-tRNA synthetase (Agrobacterium fabrum C58)
MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQ
TARAEGISPEELAQRNSDQFREMGKLLNASNDDFIRTTEERHHETSRNIWNLMADSGDIY
KDSYAGWYSVRDEAYYAEDETEVRADGVRYGPQGTPVEWVEEESYFFKLSEYQEKLLKLY
EENPDFIGPAERRNEIISFVKSGLKDLSISRTTFDWGIKVPDDPKHVMYVWVDALTNYIT
ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVYAHGFLLNKG
EKMSKSLGNVVDPANLVAHFGLDPVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGN
LASRSLSMIVKNCDGQIPTPGAFNDDDKAMLASADGLLAVCREEMGKQLIHRALAAIIAV
VSETDRYFASQEPWALKKTDPERMGTVLYVTAEVVRQIGILLQPFMPQSCEKLLDLVAAP
ADGRDFTALGEAGRLAPGTPLEAPKPVFPRYVAPEA