Protein Info for Atu1491 in Agrobacterium fabrum C58

Annotation: sodium bile acid symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 267 (27 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 1 to 329 (329 residues), 368.5 bits, see alignment E=1.7e-114 PF01758: SBF" amino acids 47 to 242 (196 residues), 99.3 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 100% identity to atu:Atu1491)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ05 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Atu1491 sodium bile acid symporter family protein (Agrobacterium fabrum C58)
MSAFERYLTVWVFLCTVVGVALGHLMPGLFQLIAAAEIAKVNIPVAVLIWLMIIPMLLKI
DFRSLSQVGAFWRGIGVTLFINWAVKPFSMAMLGWFFLGWLFRPYLPADQIDSYIAGLII
LAAAPCTAMVFVWSNLTRGEPLFTLSQVALNDAIMVVAFAPIVGLLLGLSAITVPWDTLI
LSVVLYIVVPVILAQIIRSRLMAAGTSATLDRFLSTLQPISLVALLATLILLFAFQGEQI
IAQPAVIGLLAIPILIQVYLNSGLAYLLNRMTGERHCVAGPSALIGASNFFELAVAAAIS
LFGLQSGAALATVVGVLIEVPIMLSVVWIVNRSKDWYEAAPAVSRTTITERQ