Protein Info for Atu1472 in Agrobacterium fabrum C58

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00702: Hydrolase" amino acids 1 to 181 (181 residues), 76.5 bits, see alignment E=7.7e-25 PF13419: HAD_2" amino acids 4 to 187 (184 residues), 104.6 bits, see alignment E=1.4e-33 PF12710: HAD" amino acids 4 to 178 (175 residues), 38 bits, see alignment E=4.9e-13 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 92 to 181 (90 residues), 42.9 bits, see alignment E=6.4e-15 PF13242: Hydrolase_like" amino acids 143 to 208 (66 residues), 41.3 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to atu:Atu1472)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ15 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Atu1472 hydrolase (Agrobacterium fabrum C58)
MKLVLFDCDGTLVDSAGLIHAVMSETFADFGKPRPDISETKAIIGLTLDIAIARMLGRAH
VDDEAAAMALRYKENYHPLRERFENATPLFDGIASLIDMLSKRDDVLIGAVTGKGRRGLT
QILETHGFADHFIVSRTADDCPSKPHPAMVMECCHETGMVPADTIVIGDAIYDMQMAKAA
GAKAIGVAWGYASVEDLWKAGADAVVNHPNDIPAYVPADITE