Protein Info for Atu1452 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00444: MazG family protein" amino acids 13 to 270 (258 residues), 301.3 bits, see alignment E=3e-94 PF03819: MazG" amino acids 30 to 103 (74 residues), 109.7 bits, see alignment E=7e-36 amino acids 180 to 242 (63 residues), 35 bits, see alignment E=1.4e-12 PF01503: PRA-PH" amino acids 180 to 220 (41 residues), 26.9 bits, see alignment 5.3e-10

Best Hits

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to atu:Atu1452)

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ80 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Atu1452 hypothetical protein (Agrobacterium fabrum C58)
MEASKDISRLIEIMEALRQPETGCPWDVVQTFETIKPYTIEEAYEVADAIERKDMDDLCD
ELGDLLLQVVFHARIAEERGEFTFGDVVHAVTSKMIRRHPHVFDVSDADTPDSVKLQWDQ
IKAEEKRERAERRARRGITEDFKAGFLGGVQRSQPALTEALKLQEQAARVGFDWSDPAPI
LDKIEEEIAELREALAEGKPEKVSDELGDLIFALVNIGRHVKADPEDALRGTNTKFRRRF
NHIETSLSDNGETLKEASLERMEDLWQAAKRIERSLDTVSS