Protein Info for Atu1447 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF19312: NtrY_N" amino acids 34 to 308 (275 residues), 140.4 bits, see alignment E=3.4e-44 PF00672: HAMP" amino acids 323 to 374 (52 residues), 37.8 bits, see alignment 8e-13 PF00989: PAS" amino acids 393 to 488 (96 residues), 28.4 bits, see alignment E=5.7e-10 TIGR00229: PAS domain S-box protein" amino acids 394 to 505 (112 residues), 27.1 bits, see alignment E=1.9e-10 PF08448: PAS_4" amino acids 402 to 500 (99 residues), 29.1 bits, see alignment E=3.9e-10 PF13426: PAS_9" amino acids 405 to 499 (95 residues), 29.1 bits, see alignment E=3.9e-10 PF00512: HisKA" amino acids 510 to 577 (68 residues), 36 bits, see alignment E=2.4e-12 PF02518: HATPase_c" amino acids 621 to 736 (116 residues), 65.2 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu1447)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ83 at UniProt or InterPro

Protein Sequence (753 amino acids)

>Atu1447 two component sensor kinase (Agrobacterium fabrum C58)
MRKPAAEHDVADEAAGMVVADRRMSFALPGLVLAGVALVCAIITLFVLMGVTPIAPTTNV
VIASVVINSILVIGLIFLIGREINRLLKARKKGRAAARLHVRIVVLFSIVAITPAVLVAI
FASLTLNVGLDRWFSIRTQSIVESSGNIAQAYMMENAGYLQGQTLSMATDLDRNRALFYL
DRTGFVDLMTRQAKGRGLLGAFLVQEDGDAVAQADIKTEKPLPAIPHDALEKAAAGQPTL
IPPGITNLVGAIIKLEGISGTFLYTVRAVDPKVMTAMRLMEENRAEYKNMEAGRAPLQIA
FAILYLGFALIVLLVAIWTAIAVADRIVRPIRLLISAADSVATGNMHVLVPVRAVDGDVG
RLSRTFNKMVSELRSQQEQIIEAKDDIDDRRRFIEAVLSGVTAAVIGIDENRRITIVNPS
GEEFLALNFDQLLGAQLSEIAPEIDQVVTEANTWARGNFRKQINIMRRGKERTLNVQVTR
EDARDGRDSYVITLDDITDLVIAQRSTAWSDVARRIAHEIKNPLTPIQLSAERIKRRFGK
QIDENDRAIFDQCTDTIVRQVGDIGRMVDEFSAFARMPKPTKEKSDLRSILKDAAFLREI
SAADTKFSTEFGDIPLEGMFDARMLGQAFGNLIKNATEAIEAVEGEKRPGKILVRASFDE
ANSRFVADIIDNGRGLPVENRHRILEPYMTMRDKGTGLGLAIVKKIIEEHGGYLELHDAP
AEFDHGHGAMIRVLLPYIEAVGGENNKEAAYGV