Protein Info for Atu1432 in Agrobacterium fabrum C58
Annotation: dihydrolipoamide acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to ODP2_RHIME: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhC) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to atu:Atu1432)Predicted SEED Role
"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
- pyruvate fermentation to acetate V (3/3 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- pyruvate fermentation to acetate II (1/3 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (1/4 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glycolysis / Gluconeogenesis
- Pyruvate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7CZ96 at UniProt or InterPro
Protein Sequence (405 amino acids)
>Atu1432 dihydrolipoamide acetyltransferase (Agrobacterium fabrum C58) MEAVDEGTVAKLVVPAGTEAVKVNALIAILAAEGEDVAEAAKGGDAVPAKAEAPKPEAAK AEAPKEEAAPVKAEKPVADQAAASSTPAPVAKSGERIFASPLARRLAKEAGLDLSAVSGS GPHGRIVKTDVEKAAASGGAKAAPAAAASAGAPAPALAKGQSDEAVLKLFEQGSYELVPH DGMRKVIAKRLVESKQTVPHFYVSVDCELDTLLALRAQLNAAAPEKDGKPVYKLSVNDMV IKALALALRDVPDANVSWTESAMVKHKHADVGVAVSIPGGLITPIIRKAEEKSLSTISNE MKDYGKRAKERKLKPEEYQGGTTAVSNMGMMGVKSFSAVINPPHATILAVGAGEQRAVVK NGEIKIANVMTVTLSTDHRCVDGALGAELIGAFKRYIENPMGMLV