Protein Info for Atu1406 in Agrobacterium fabrum C58

Annotation: isomerase/lactonizing enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02746: MR_MLE_N" amino acids 13 to 109 (97 residues), 63.1 bits, see alignment E=2.9e-21 PF13378: MR_MLE_C" amino acids 161 to 384 (224 residues), 183.5 bits, see alignment E=4.8e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1406)

Predicted SEED Role

"Gluconate dehydratase (EC 4.2.1.39)" in subsystem Entner-Doudoroff Pathway (EC 4.2.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.39

Use Curated BLAST to search for 4.2.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ44 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Atu1406 isomerase/lactonizing enzyme (Agrobacterium fabrum C58)
MKITSVETLRTEEFSNVLWVRIHTDAGVIGLGETFYGAGAVEAHIHDVLAGRLLGRDPMR
IEAHSRELVNLPMAQASTGAEYRAASAIDLALWDIFGKVCNQPVHQMLGGLCHDRIPVYN
TCAGYGYVRSNKIKPVDTWNFRDDAEGPYEDLRAFMTDAGALAENLLEQGISAMKIWPFD
PAAIENDGRYITSEQLRAALLPFEQIRKRVGDRMQIMVEFHSLWNLPTIKKIARELEAFD
PTWYEDPIRMNSVSALSELAASTSVPICASETLGSRFPYKDMLEAGAIGIVMTDLVWTGG
LTEGRKIAALADTYHRPYAPHDCTGPVAYAAAVHSSFSQTNTMIQESVRAFYTGWYCELV
TNLPVIENGFVLPMEGPGLGTELLPKVFERPDLTVRVSTL