Protein Info for Atu1395 in Agrobacterium fabrum C58

Annotation: LexA repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF01726: LexA_DNA_bind" amino acids 2 to 63 (62 residues), 59.2 bits, see alignment E=2.9e-20 TIGR00498: repressor LexA" amino acids 2 to 239 (238 residues), 179.2 bits, see alignment E=3.8e-57 PF00717: Peptidase_S24" amino acids 118 to 233 (116 residues), 113 bits, see alignment E=6.6e-37

Best Hits

Swiss-Prot: 100% identical to LEXA_AGRFC: LexA repressor (lexA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 100% identity to atu:Atu1395)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFK2 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Atu1395 LexA repressor (Agrobacterium fabrum C58)
MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR
ARALEVIKLPEAYTPGARPQRGFSPSVIEGSLGKPKEPEPAPAVKAPANDFAGAATIPVM
GRIAAGVPISAIQNNTHDLAVPVDMLGSGEHYALEVKGDSMIEAGIFDGDTVIIRNGNTA
NPGDIVVALVDDEEATLKRFRRKGASIALEAANPAYETRIFGPDRVKIQGKLVGLIRRYH