Protein Info for Atu1384 in Agrobacterium fabrum C58

Annotation: acyl-(acyl carrier protein)--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00132: Hexapep" amino acids 2 to 35 (34 residues), 28.2 bits, see alignment 1.1e-10 amino acids 19 to 54 (36 residues), 34.3 bits, see alignment 1.3e-12 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 10 to 264 (255 residues), 324.6 bits, see alignment E=1.8e-101 PF13720: Acetyltransf_11" amino acids 182 to 264 (83 residues), 62.1 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 100% identical to LPXA_AGRFC: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to atu:Atu1384)

MetaCyc: 49% identical to acyl-[acp]--UDP-3-acetamido-2-amino-2,3-dideoxy-alpha-D-glucopyranose N-acyltransferase monomer (Brucella abortus 2308)
RXN2B4Q-48 [EC: 2.3.1.305]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129 or 2.3.1.305

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFL3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Atu1384 acyl-(acyl carrier protein)--UDP-N-acetylglucosamine O-acyltransferase (Agrobacterium fabrum C58)
MSTIAASAKIHPTAVVEDGAVIGENVVIGALAYVGPKVTLHDDVRLHNHAVVSGLTVIGR
GSVVHPMAVIGGTPQAVRHDGSETTLEIGERCIMREGVTMNAGSSDGGGKTIVGDDNLFL
ANSHVAHDCRLGRHIILSNNVMLAGHVTIEDRAILGGGCAVHQFTRIGRQAFIGGLSAVN
YDVIPYGMLNGNPGILGGLNVVGMTRSGIERADIHKVRRVYKAIFEAEGTIRGNAAAIDR
NDYLDCPQALEIIDFIGAGSDRAISSPNRGK