Protein Info for Atu1381 in Agrobacterium fabrum C58

Annotation: group 1 outer membrane protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 39 to 774 (736 residues), 774.3 bits, see alignment E=6.8e-237 PF07244: POTRA" amino acids 39 to 104 (66 residues), 31 bits, see alignment E=7e-11 amino acids 108 to 183 (76 residues), 51.1 bits, see alignment E=3.7e-17 amino acids 187 to 274 (88 residues), 63 bits, see alignment E=7.2e-21 amino acids 278 to 356 (79 residues), 39.1 bits, see alignment E=2.1e-13 amino acids 360 to 430 (71 residues), 55 bits, see alignment E=2.2e-18 PF01103: Omp85" amino acids 459 to 774 (316 residues), 319.8 bits, see alignment E=5.1e-99

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 100% identity to atu:Atu1381)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ61 at UniProt or InterPro

Protein Sequence (774 amino acids)

>Atu1381 group 1 outer membrane protein precursor (Agrobacterium fabrum C58)
MKAGSRFLNAVSAVALSAGVSSVAGLGVLASAGVANAAVISKIDVRGAERSGADSVRSNI
TIAPGKNFSNSDIDESVKRLYATGYFSNVSMRVSGSTLVVTVNENQLVNQVVFNGNRKIK
DDKLAGIVQTQPMGPFNQAIVTADIARIKEAYSAIGRSDVEITTQTVSVGQGRVNIAFVI
NEGERTKIGRIDFIGNNSYSDGRLAAVINTKKSNMLSFLTRKDVYNEDKLRADEEALRQF
YYNRGYADFRVVSSDAVLDESKNEYTISITVDEGKKYDFGNVAVESTVPGVDGSELQGLV
ETRQGASYSAKEVQQSMEAISKRVAGEGYPFARVTPRGDRDMSGNTIGVTYIVDQGERAY
VERIEIRGNTRTRDYVIRREFDISEGDAFNQTIITAAKRRLEALGYFSKVNISTAGGSAP
DRVVIVVDVEDQSTGSFGIGAGYSQNDGVLLEASVEEKNFLGRGQYIRVAAGAGEDDART
YSLSFTEPYFLGYRLAAGFDLFKNQSKSEDYYNYDEQGFALRVTAPITENLSTTFKYTYK
QINYEGKGDWQNNANLAEPYQALIRGEDWTQSILSNTLNYNTLDDRNMPREGWQAALTNE
FAGLGGDSEYYKIYAKARYYYTLSDEYDVIGSLTGQAGHVMPTGDNLLVFDQFKFGGRQV
RGFKNDGIGPRIGSDSIGGTTYFAASAEVTAPMPGVPEDFGLRLAGFVDAGTMYGNKVST
SQTVKDDNSIRASAGIGVMWASPFGPIRVDYAIPIAKEDYDEEQRFRFGMSNTF