Protein Info for Atu1378 in Agrobacterium fabrum C58

Annotation: undecaprenyl pyrophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 9 to 236 (228 residues), 283.1 bits, see alignment E=7.2e-89 PF01255: Prenyltransf" amino acids 16 to 236 (221 residues), 292.9 bits, see alignment E=7.6e-92

Best Hits

Swiss-Prot: 100% identical to ISPT_AGRFC: Isoprenyl transferase (uppS) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to atu:Atu1378)

MetaCyc: 52% identical to (2Z,6E)-farnesyl diphosphate mono-trans,poly-cis-dodecaprenyl diphosphate synthase (Thermobifida fusca)
RXN-11487 [EC: 2.5.1.88]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31 or 2.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFL9 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Atu1378 undecaprenyl pyrophosphate synthase (Agrobacterium fabrum C58)
MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLF
AFSSENWRRPESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAE
QMTAGNTKLTLVIAFNYGSRDEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPD
PDLIIRTSGEERLSNFLLWQAAYSEFLFVPEYWPDFDRQRFFSAIEQYATRDRRFGALAE
QVAVAGA