Protein Info for Atu1364 in Agrobacterium fabrum C58

Annotation: ATP-dependent Clp protease, ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 836 PF02861: Clp_N" amino acids 4 to 128 (125 residues), 111 bits, see alignment E=2.9e-35 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 5 to 751 (747 residues), 1177.1 bits, see alignment E=0 PF00004: AAA" amino acids 228 to 360 (133 residues), 47 bits, see alignment E=2.1e-15 amino acids 509 to 624 (116 residues), 42 bits, see alignment E=7.7e-14 PF17871: AAA_lid_9" amino acids 367 to 468 (102 residues), 90.6 bits, see alignment E=3.3e-29 PF07724: AAA_2" amino acids 503 to 664 (162 residues), 197.4 bits, see alignment E=1.1e-61 PF00158: Sigma54_activat" amino acids 509 to 631 (123 residues), 21.6 bits, see alignment E=9.2e-08 PF07728: AAA_5" amino acids 510 to 626 (117 residues), 46.1 bits, see alignment E=3.2e-15 PF10431: ClpB_D2-small" amino acids 672 to 750 (79 residues), 90.1 bits, see alignment E=4.5e-29

Best Hits

Swiss-Prot: 70% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to atu:Atu1364)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ66 at UniProt or InterPro

Protein Sequence (836 amino acids)

>Atu1364 ATP-dependent Clp protease, ATP-binding subunit (Agrobacterium fabrum C58)
MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMAACNVDLDALRKTV
SDYVDNELTNLVTGYDEDSKPTSGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESH
AAYFLQEQEMTRYDAVNYISHGIGKRPGTSQTRAPRGADEPESESKPSRGNPEEDGSSAK
KQQDALKAYCVNLNDKARNGKIDPLIGRHDEVNRTIQILCRRSKNNPLYVGDPGVGKTAI
AEGLAKRIVEGKVPEALANDTIFSLDMGTLLAGTRYRGDFEERLKQVVKELEEFPGAVLF
IDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQK
IDVNEPSIDDAIAIMKGLKPYFEDYHHLRYSNEAIKAAVELSARYISDRKLPDKAIDVID
ETGAAQMLLPASKRRKLITEREIEATIATMARIPPKTVSKDDEMVLANLEKELRSVVYGQ
DIAIEALATAIKLARAGLREPNKPIGSYVFSGPTGVGKTEVAKQLAASLGVEMLRFDMSE
YMERHTVSRLLGAPPGYVGFDQGGLLTDGVDQHPHSVVLLDEIEKAHPDIYNILLQVMDH
GSLTDHNGKKIDFRNVILIMTTNAGASEMAKSAIGFGSSRRTGEDEEAINRLFTPEFRNR
LDAIIPFSPLPTAVIHKVVQKFVMQLETQLSERNVTFDLHEDAISWLAEKGYDEKMGARP
LSRVIQEHIKKPLANEILFGKLKKGGVVSVTVGKKDDGADGLILEVLPETAPVKPQPEAE
LKAAKSPGKPKAKAKTASKAAKTADEAEILVAEADKSDEDKPRRKTNTVPKVPKKK