Protein Info for Atu1347 in Agrobacterium fabrum C58

Annotation: Tetracycline resistance protein, tetM/tetO subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 TIGR00231: small GTP-binding protein domain" amino acids 1 to 157 (157 residues), 95 bits, see alignment E=2.1e-31 PF00009: GTP_EFTU" amino acids 2 to 248 (247 residues), 175 bits, see alignment E=2.7e-55 PF14492: EFG_III" amino acids 348 to 421 (74 residues), 35.8 bits, see alignment E=1.4e-12 PF03764: EFG_IV" amino acids 445 to 539 (95 residues), 61 bits, see alignment E=1.9e-20 PF00679: EFG_C" amino acids 542 to 624 (83 residues), 45.4 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1347)

Predicted SEED Role

"Ribosome protection-type tetracycline resistance related proteins" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ73 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Atu1347 Tetracycline resistance protein, tetM/tetO subfamily (Agrobacterium fabrum C58)
MRTLNLGILAHVDAGKTSLTERLLFDVGVIDKLGSVDTGNTQTDSLELERQRGITIRAAV
VSFTIGDTVVNLIDTPGHPDFIAEVERVLGLLDAAVVVVSAVEGVQAQTRVLVRALQRLA
VPFLFFINKVDRVGARYDEVVRDLADQLRVRPVVMSKITGAGSKHVQVAATDTECEPLFT
ILCETLAENDDELLRDYLLTPDRVDAGRLSLLLGQQTACGVVHPAFAGVAMTGAGLPALI
AAITEMLPARDPDPEGEISGKIFKIERGWGGEKLSYLHLASGTVRLRHILPLPQGPARLT
GIQLFKDGRVQNANSLGAGQIARVTGLAGARVGDSVGVDAVADGAFHFAPPTLETRVVSR
RPSEHAALWLALNQMVEQDPLIGLRRNDETNEVFVSLYGEVQKQIIQSELSTGFGIEAEF
EDSTVICVERLSGSGQGLQTIFREPNPFFATIGLRVEPRPDGAGNSFALEVEFGQMPASF
YRAVEETVFDTLKQGVFGWQVQDCHVAMTAARHTSPSSTAADFRKLTPWVLGTALKQAQP
FVCEPFDHFHIEAPAAAITRLISLLAKAGAATKNSVISGGVATLEGTIASAAVQGVQQQV
PGLTSGLGGMETSFSHYAQAESPPSPRRRSGPDPFNECDYLLRMRRNAE