Protein Info for Atu1345 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF01513: NAD_kinase" amino acids 27 to 75 (49 residues), 25.7 bits, see alignment 1.2e-09 PF20143: NAD_kinase_C" amino acids 116 to 231 (116 residues), 40.9 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 74% identical to NADK_RHIME: NAD kinase (nadK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 100% identity to atu:Atu1345)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ74 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Atu1345 hypothetical protein (Agrobacterium fabrum C58)
MSHSTYSLSFVASPSEEAQTALKELKAVYSDTPFEEADVIVALGGDGFMLQILNETMNSG
KRVYGMNRGSVGFLMNDFRVEGLIQRIAVASGNDFHPLRMTTTDSDGDEFTALAMNEVSL
FRQSHQAAKLRVEVDGKVRLEELICDGMMVATPAGSTAYNFSAHGPILPLESPLLALTPV
SAFRPRRWRGALLPNKVTVDIHVLERDKRPVNAVADHTEVKSVRHVRIAQSQDRTAKILS
DPDRSWSDRVLAEQFNN