Protein Info for Atu1306 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PLSY_AGRFC: Glycerol-3-phosphate acyltransferase (plsY) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to atu:Atu1306)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

phosphatidylglycerol biosynthesis I (6/6 steps found)
phosphatidylglycerol biosynthesis II (6/6 steps found)
superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
CDP-diacylglycerol biosynthesis I (4/4 steps found)
CDP-diacylglycerol biosynthesis II (4/4 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
oleate biosynthesis III (cyanobacteria) (2/3 steps found)
phosphatidate biosynthesis (yeast) (3/5 steps found)
diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
palmitoyl ethanolamide biosynthesis (2/6 steps found)
superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
stigma estolide biosynthesis (2/7 steps found)
anandamide biosynthesis II (2/8 steps found)
anandamide biosynthesis I (3/12 steps found)
superpathway of phospholipid biosynthesis II (plants) (12/28 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFU1 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Atu1306 hypothetical protein (Agrobacterium fabrum C58)
MTDWQTAPALLALAALIGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNKKL
AAATLLLDALKGTAAVLVANALWGYEASLVAGFFAFLGHLFPVWLGFKGGKGVAVYIGVL
LGAAPLMMLAFALIWLATAFITRYSSLSALLAMLIIPVALWVLGPEKTAMLVTLLSVISW
WKHRENIRRLMAGTESRIGQKG