Protein Info for Atu1300 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 206 to 232 (27 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 240 (215 residues), 74.9 bits, see alignment E=5.7e-25 amino acids 215 to 380 (166 residues), 47.3 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1300)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ97 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Atu1300 MFS permease (Agrobacterium fabrum C58)
MSQMKCEEADAIHWPSLIAAISAISAVGVAIGLGLPLLSIILEKRGISSTMIGVNSAMAG
VAAMMAAPVTTKIAHDFGVARTMLLAVVISALSALCFYFADAFWMWFPLRIVFHGATTTL
FILSEYWINTTAPPKKRGMVLGIYATGLAVGFAVGPLLFSVVGSEGILPFIVGAAIILLA
AIPIFMARGESPELDEHPNHHFIRYVWLVPMASAAAFVFGSVQAGGLSLFPIYATREGFN
ESQAALLLTVMGIGNMVFQIPIGLLSDRLKDRRTLLALMAFAGVCGTLALPLLVDSWILV
AALLLFWGGLVSGMYTVGLTHLGSRLKGADLVSANAAFIFCYAMGTIAGPQAVGISMDVA
GTDGFAWALAVFFGLYVVLYGFRFVFRAKQA