Protein Info for Atu1297 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 105 bits, see alignment E=2.6e-34 amino acids 157 to 266 (110 residues), 38.7 bits, see alignment E=9.8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 290 to 454 (165 residues), 187.4 bits, see alignment E=8.1e-60 PF00990: GGDEF" amino acids 291 to 450 (160 residues), 168.4 bits, see alignment E=1.1e-53

Best Hits

Swiss-Prot: 51% identical to PLED_CAUVN: Response regulator PleD (pleD) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02488, two-component system, cell cycle response regulator (inferred from 100% identity to atu:Atu1297)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ98 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Atu1297 two component response regulator (Agrobacterium fabrum C58)
MTARVLVVDDIPANVKLLEARLVAEYFDVVTAEDGFKALAICDEEQVDIILLDIMMPGMD
GFEVCERLKANPNTAHIPVVMVTALDQPSDRVRGLKAGADDFLTKPVNDLQLIARVKSLV
RLKAVSDELRLRAETARQIGIEEMLRSDGLMQTPGRVLVADGRASSQERIIRALKPVAEV
DAVTEPQAALLKAASSPFELVIVNSNFEDYDPLRLCSQFRSLERTRFLPLLLVAEQGADE
MVARALDLGVNDYILRPIDPNELVARSLTQIRRKRYNEHLRLNLQHTMELAIVDGLTGLN
NRRYLDSHLKILFDRAAVRGRPISICMTDIDRFKLVNDTYGHDVGDEVLREFAARIRSTV
RGADLACRYGGEEFVVVMPDTPIELAASVAERLRAIVEDKPFYVRSIDRELSITASLGIA
TSSGAFGAPDEILKQADKALYEAKHAGRNRVVAAAA