Protein Info for Atu1289 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 41 to 68 (28 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 336 to 362 (27 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 25 to 435 (411 residues), 498.3 bits, see alignment E=8.4e-154 PF12704: MacB_PCD" amino acids 51 to 258 (208 residues), 53.8 bits, see alignment E=3.3e-18 PF02687: FtsX" amino acids 295 to 428 (134 residues), 42 bits, see alignment E=8.9e-15

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to atu:Atu1289)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJA0 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Atu1289 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MAKADADKGAAPSARERTARPFSAFERMVAWRYLRSRRKEAFISVIAGFSFVGIMLGVAT
LIIVMAVMNGFRTELISRILGINGHMIVQPIDQPFNNYDELAKKFSAVPGVTMALPLVEG
QTLASGRGGAGSGALVRGVRQEDIDKIKEVATNIKTGDLVGFMAGDGVLVGSRLASQLGV
TAGDDITLISPEGDVTPMGINPRVKSYKISGVFEIGMSEYDASMIYMPLSEAQLYFNANG
IVQSIELYVSRPDDVDGIRPLVEQAAERQIYITDWRQRNQTFFSALQVERNVMFMILTLI
VLVAALNIISGLIMLVKDKGSDIAILRTMGASSGAVMRIFFMTGAAIGTVGTFAGVALGV
LVCLNVESIRQFFSWVSGTVLFDPQLYFLSQLPAEMDLSETITVVIMALTLSFLATIFPA
WRASKLDPVQALRYE