Protein Info for Atu1278 in Agrobacterium fabrum C58

Annotation: NADH ubiquinone oxidoreductase chain I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 20 to 141 (122 residues), 161.1 bits, E=4.1e-52
• PF00037: Fer4
  • amino acids 60 to 79 (20 residues), 24 bits, see alignment (E = 1.4e-08)
  • amino acids 97 to 118 (22 residues), 31.3 bits, see alignment (E = 7.3e-11)
• PF12800: Fer4_4
  • amino acids 61 to 75 (15 residues), 18 bits, see alignment (E = 1.6e-06)
  • amino acids 102 to 115 (14 residues), 12.2 bits, see alignment (E = 0.00011)
• PF13187: Fer4_9
  • amino acids 62 to 118 (57 residues), 36.1 bits, E=3e-12
• PF12838: Fer4_7
  • amino acids 62 to 117 (56 residues), 46.2 bits, E=2.7e-15

Best Hits

Swiss-Prot: 100% identical to NUOI_AGRFC: NADH-quinone oxidoreductase subunit I (nuoI) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 99% identity to agr:AGROH133_05642)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See Q8UFW9 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Atu1278 NADH ubiquinone oxidoreductase chain I (Agrobacterium fabrum C58)
MASLSQAVNSLFLKEFVGAIFLTMRHFFKQKATINYPFEKGPVSPRFRGEHALRRYPNGE
ERCIACKLCEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACPVDAIVE
GPNFEFATETREELYFDKQRLLDNGDRWEREIARNLALDAPYR