Protein Info for Atu1277 in Agrobacterium fabrum C58

Annotation: NADH ubiquinone oxidoreductase I chain H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details PF00146: NADHdh" amino acids 20 to 338 (319 residues), 392.6 bits, see alignment E=6.4e-122

Best Hits

Swiss-Prot: 100% identical to NUOH_AGRFC: NADH-quinone oxidoreductase subunit H (nuoH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to atu:Atu1277)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFX0 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Atu1277 NADH ubiquinone oxidoreductase I chain H (Agrobacterium fabrum C58)
MEQFFWSYVWPALIMVGQSLLLLVCLLVAIAFLLLADRKVWAAVQLRRGPNVVGPFGLFQ
SFADLLKFILKEPVIPAGANKAVFLLAPLVAVTLALATYAVIPFADGWVVANINVGILYI
FAISSLEVYGIIMGGWASNSKYPFLGALRSAAQMVSYEVSIGLVIVTVLLCVGSLNLTDI
VLAQRTGLGTMMGLPASFLDWHWLSLFPMFIVFFISGLAETNRPPFDLPEAESELVAGHM
VEYGSTPYMMFMLGEYAAIVLICCLTTILFLGGWLPIVDVWFLNWVPGIVWFALKGCMVF
FMIALTKAFVPRYRYDQLMRLGWKVFLPLSLAMVVIVAFVLKLTGWAG