Protein Info for Atu1275 in Agrobacterium fabrum C58

Annotation: NADH ubiquinone oxidoreductase chain F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 105 to 124 (20 residues), see Phobius details TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 8 to 416 (409 residues), 648 bits, see alignment E=2.1e-199 PF01512: Complex1_51K" amino acids 48 to 216 (169 residues), 166.2 bits, see alignment E=1e-52 PF22461: SLBB_2" amino acids 240 to 303 (64 residues), 46 bits, see alignment E=9.2e-16 PF10531: SLBB" amino acids 242 to 292 (51 residues), 34.2 bits, see alignment 3.8e-12 PF10589: NADH_4Fe-4S" amino acids 332 to 414 (83 residues), 113.5 bits, see alignment E=6.6e-37

Best Hits

Swiss-Prot: 83% identical to NUOF1_RHIME: NADH-quinone oxidoreductase subunit F 1 (nuoF1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 100% identity to atu:Atu1275)

MetaCyc: 70% identical to NADH-ubiquinone oxidoreductase 51 kDa subunit (Arabidopsis thaliana col)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJA6 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Atu1275 NADH ubiquinone oxidoreductase chain F (Agrobacterium fabrum C58)
MLKDQDRIFTNLYGLKDKSLKGVMARGHWDGTKQIIEKGRDWIINEMKASGLRGRGGAGF
PTGLKWSFMPKENDGRPHYLVVNADESEPGTCKDREILRNDPHTLIEGCVIAGFAMGAHT
AYIYVRGEYMREREALQAAIDECYDAGLLGKNNKNGWDYDIYVHHGAGAYICGEETALLE
SLEGKKGQPRLKPPFPANMGLYGCPTTVNNVESIAVAPTILRRGASWFSSIGRPNNVGTK
LFMVSGHVERPCTFEDALGLSFRELIEHHCGGIRGGWDNLLGVIPGGASCPIVRGEDMKD
AIMDFDGMREVKSSFGTGGMIVMDKSTDVIKAIARIAAFFKHESCGQCTPCREGTGWMWR
VLERMVKGNAQKREIDMLFEVTKQIEGHTICALGDAAAWPVQALIRNFRPEIEKRIDQYT
YRAMDDGAVLEAAE