Protein Info for Atu1257 in Agrobacterium fabrum C58

Annotation: GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 212 to 376 (165 residues), 141.9 bits, see alignment E=8e-46 PF00990: GGDEF" amino acids 216 to 373 (158 residues), 132.1 bits, see alignment E=8.1e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1257)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZM8 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Atu1257 GGDEF family protein (Agrobacterium fabrum C58)
MLDAKTSTLLWAAETFTLAVLLGTLWLHRPSRRHNLYFAAGFLATGFGTVMVALRGDISS
FLSIQVGNTLALSAFGFWLAGLLSLEQRKLGGWIAIPALLWIAGMFVPSVPEDMVARILL
YHASAATGYFMLAGVLLGSRARASRSRKVLATILILQAFAGAIVASIVIPANAAVPNAIP
MTSALSISGMLGFTAIIMISAKIIMEDTEIRLHRLAMTDHLTGVLNRRGLLEEFEHIKKR
SHGSDRYVALVLFDIDHFKKINDRYGHQSGDAVLVHFCNIAQRVIGERGLFVRMGGEEFA
LVAEVESPSSTVTLAEAIRSNLRLSKITARNEAIKVTTSVGISEAMIKDADLSVMMTEAD
RALYAAKKAGRNRTVIHVNSANVVVPAPDRDENPMDNNADRQVAALNRISAIASR