Protein Info for Atu1256 in Agrobacterium fabrum C58

Annotation: cytochrome P450 hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF00067: p450" amino acids 92 to 264 (173 residues), 30.3 bits, see alignment E=1e-11 amino acids 290 to 387 (98 residues), 68.9 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: K00493, unspecific monooxygenase [EC: 1.14.14.1] (inferred from 100% identity to atu:Atu1256)

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJB6 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Atu1256 cytochrome P450 hydroxylase (Agrobacterium fabrum C58)
MTATFPFLKIDPATRRVSLNARDPAFYNDPNPVYAALHAQCPTFYWEEQRQWFFTCYDHV
STLLRDRRFGRQILHVASREEIGLPEPLEHVKHFDLAEQHSLLELEPPEHTRLRTLINRA
FVSRHVDKMKPEIEELANRLIEAFEANGETELLSSYADIIPVTMIARMIGIPEEMGPQLL
KWSHAYVGMYMFKRTPEDELLADKAAQEFSDYVRRVIAERRAEPKDDLLSHMIHTEHKGQ
YLTDDELVSTTIVLLNAGHEATVHQIGNSVRIILESGLDPKTLFHDETATERTVEETLRI
CAPVHIFQRWVLEPVEIDGVQFKRGDKVSLILAAANLDPAKFSDPLAFQPDRNEGANVSF
GAGIHFCIGAPLARLELNLALPLLFKRLPGLKIAEPPKVKDVYHFHGLERLDLAW