Protein Info for Atu1256 in Agrobacterium fabrum C58
Annotation: cytochrome P450 hydroxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00493, unspecific monooxygenase [EC: 1.14.14.1] (inferred from 100% identity to atu:Atu1256)Predicted SEED Role
"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase
MetaCyc Pathways
- acetone degradation I (to methylglyoxal) (3/3 steps found)
- acetone degradation III (to propane-1,2-diol) (1/2 steps found)
- 1,5-anhydrofructose degradation (3/5 steps found)
- vanillin biosynthesis I (1/3 steps found)
- melatonin degradation I (2/5 steps found)
- bupropion degradation (1/5 steps found)
- superpathway of melatonin degradation (2/11 steps found)
- nicotine degradation V (3/18 steps found)
- nicotine degradation IV (1/16 steps found)
KEGG Metabolic Maps
- Androgen and estrogen metabolism
- Arachidonic acid metabolism
- Biosynthesis of alkaloids derived from shikimate pathway
- C21-Steroid hormone metabolism
- Caffeine metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Fatty acid metabolism
- Linoleic acid metabolism
- Metabolism of xenobiotics by cytochrome P450
- Retinol metabolism
- Tryptophan metabolism
- gamma-Hexachlorocyclohexane degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.14.14.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CJB6 at UniProt or InterPro
Protein Sequence (415 amino acids)
>Atu1256 cytochrome P450 hydroxylase (Agrobacterium fabrum C58) MTATFPFLKIDPATRRVSLNARDPAFYNDPNPVYAALHAQCPTFYWEEQRQWFFTCYDHV STLLRDRRFGRQILHVASREEIGLPEPLEHVKHFDLAEQHSLLELEPPEHTRLRTLINRA FVSRHVDKMKPEIEELANRLIEAFEANGETELLSSYADIIPVTMIARMIGIPEEMGPQLL KWSHAYVGMYMFKRTPEDELLADKAAQEFSDYVRRVIAERRAEPKDDLLSHMIHTEHKGQ YLTDDELVSTTIVLLNAGHEATVHQIGNSVRIILESGLDPKTLFHDETATERTVEETLRI CAPVHIFQRWVLEPVEIDGVQFKRGDKVSLILAAANLDPAKFSDPLAFQPDRNEGANVSF GAGIHFCIGAPLARLELNLALPLLFKRLPGLKIAEPPKVKDVYHFHGLERLDLAW