Protein Info for Atu1250 in Agrobacterium fabrum C58
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to YCCU_ECOLI: Uncharacterized protein YccU (yccU) from Escherichia coli (strain K12)
KEGG orthology group: K06929, (no description) (inferred from 100% identity to atu:Atu1250)Predicted SEED Role
"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-methionine biosynthesis III (4/4 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-homocysteine biosynthesis (2/2 steps found)
- L-methionine biosynthesis I (4/5 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
- homocysteine and cysteine interconversion (1/4 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Cysteine metabolism
- Methionine metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.48, 2.5.1.49
Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CJC0 at UniProt or InterPro
Protein Sequence (144 amino acids)
>Atu1250 hypothetical protein (Agrobacterium fabrum C58) MQHDTYEPDYLRKILTDVKTIALLGASPNPDRPSHGVMRFLLSKGYRVFPVNPGQAGKEI LGQKVYARLADIPEAIDMIDVFRAPEYLSAIVEEAILLPDRPSVIWGQLSVRDDNAAAKA EAYGMDVVMDRCPAIEYPRLNIAR