Protein Info for Atu1248 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 35 to 51 (17 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details PF00892: EamA" amino acids 140 to 275 (136 residues), 50.4 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1248)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJC1 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Atu1248 hypothetical protein (Agrobacterium fabrum C58)
MTFDILLLVLLGAVLHAGWNALVKSGSDKSLDASLIAAGAAACSLPFLPFLPFPAPVAIP
FLIASAVLQFAYFRLVAAAYTIGDIGLVYPVMRGVAPLIVAATSSLFLSEVLSPLALAGI
AVISGGILTLAFEARRGGGKAILVALLNAFVIASYTFVDGVGARLSGNAISYTLWMSLLP
PVLLFGFAFYQRGVGPVARHVQRNWWRGLIGGGGSILSYGLALYAMTKAPVAVVAALRET
SILFALVISVVILKERASIWRYLAGGIIAAGVLVMRLG