Protein Info for Atu1244 in Agrobacterium fabrum C58

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 3 to 308 (306 residues), 425 bits, see alignment E=9e-132 PF01118: Semialdhyde_dh" amino acids 43 to 102 (60 residues), 33.5 bits, see alignment E=4.9e-12 PF22698: Semialdhyde_dhC_1" amino acids 117 to 291 (175 residues), 86.9 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 100% identical to ARGC_AGRFC: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to atu:Atu1244)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UG00 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Atu1244 N-acetyl-gamma-glutamyl-phosphate reductase (Agrobacterium fabrum C58)
MTAKIFIDGEHGTTGLQIRTRLAGRRDIELLSIPETERRNAAMREDLLNNADISILCLPD
DASKEAVSMVAGNNNVRIIDTSTAYRVHQDWAYGFAEMDRDQGEKVRSARFVANPGCYPT
GAIGLIRPLRASGILPDGYPVSVNAVSGYTGGGKQMIAQMEDQSRDDAISANNFLYGLTL
KHKHVPEMTIHGQLDRAPLFAPSVGRFPQGMIVQVPLFAADLAEGTTIETIHAALTAHYA
GQDIVSVVPLAESKGISRIDAEELAGKDTMKLFVFGTPGGEHINLVALLDNLGKGASGAA
VQNMELMLSA