Protein Info for Atu1226 in Agrobacterium fabrum C58

Annotation: exoD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 138 to 170 (33 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details PF06055: ExoD" amino acids 14 to 195 (182 residues), 173.6 bits, see alignment E=1.4e-55

Best Hits

Swiss-Prot: 68% identical to EXOD_RHIME: Protein ExoD (exoD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1226)

Predicted SEED Role

"exopolysaccharide synthesis protein ExoD-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZQ0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Atu1226 exoD protein (Agrobacterium fabrum C58)
MTNEFAFTDTSEKLSTTLEKLIAKLQGQTITLRELMEAIGEQGLLLICAIASLPFLIPVS
IPGVSTVFGAAIILVSLAITLNRLPWLPAKILDRQMETAKLVPALQKGVAIVSKLDGYIR
PRIPALTTGVVTNRINGLALMTAGVLLMMPLGFIPFSNTLPGVAILLLSAGMIQRDGVTV
LGGYLFLGLTAIYFTALAYAAFWAGQGISSSIGS