Protein Info for Atu1199 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details PF12911: OppC_N" amino acids 34 to 76 (43 residues), 35.6 bits, see alignment 7.2e-13 PF00528: BPD_transp_1" amino acids 117 to 288 (172 residues), 100.3 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 38% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu1199)

MetaCyc: 32% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport system permease protein NikC (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJD9 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Atu1199 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MTTSLFPSAPAAAMPMTLPTRPSTLSRFTDFIRRRHWTFYAGSAIFLAIVLLLVIAPWIS
PYNPAQQNLRLRLNAPSATYWLGTDHLGRDVLSRLLIGGRFTVTIAAITVILSVGIGTFI
GIISGRSRGILDEVLMRVVDLLIAIPDVVIAIFLVAIFGPGYGTLIASLTIVGWTPFARL
ARGLTLAINSREYIRAAEVLGCTRRFIIFRHIIPNTIWPIAAVAFLRFGHKLITVGGLSF
LGLGVQPPAADWALMLSDAQAYAERMPILVIAPGLAIFLSALSVTWIGHGLNLETKKTNN
H