Protein Info for Atu1196 in Agrobacterium fabrum C58

Annotation: naphthalene 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00111: Fer2" amino acids 12 to 82 (71 residues), 53.3 bits, see alignment E=4.4e-18 PF00970: FAD_binding_6" amino acids 109 to 197 (89 residues), 35.4 bits, see alignment E=2.3e-12 PF00175: NAD_binding_1" amino acids 211 to 311 (101 residues), 70.4 bits, see alignment E=4.1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1196)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJE2 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Atu1196 naphthalene 1,2-dioxygenase (Agrobacterium fabrum C58)
MPGNTIYLPQIGRSIMAAEGETVLQAALAAGIAYPRGCRMGRCGACKSHLISGEIDLLKH
TPFSLTEEEKAEGLTLACRAVPASDVTIGWLDGEDEFADIPTGRFEGVVEEAVDATHDIK
LIRIRLEDRAQFTFKPGQYVRLLYPDSSPRDYSIASRVDEELIEFHIRHVPGGMTSGRIF
SLARAGDPVTIVGPFGSSFLREKHCGPILGIAGGSGLAPVKAVVEAALATGRERPVHVYF
GARAERDLYMLDRFQDLTTRHGNLSFVPVLSNEDHANIRRGYVGAAVADDFDDLDGWKAY
IAGPPAMIEATVPQLLARGMRTADIHADVFFTPER