Protein Info for Atu1173 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 352 (332 residues), 72.4 bits, see alignment E=3.4e-24 PF00083: Sugar_tr" amino acids 55 to 128 (74 residues), 23 bits, see alignment E=3.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1173)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJE8 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Atu1173 MFS permease (Agrobacterium fabrum C58)
MSVVSVPGLEVQLDEAKRNVFLLTMAQAIMGSAAPLSFSVGALAGYQLLGADKSLATAPL
TGFNIGVALGAICVAAASRFLGRKAGFMVGALMCSIGGGIAAVALFRSDFWLFAVGLLLI
GISGGFTQKIRFAAADASPSFYKAKAISWILAGGIISAIVGPQLAIFGKDLLAPVTFAGA
FIALVPLGLVSIAILSFLKLPDPKTASTHAEEVRPLSEIVRTQRFVTGMICGIGSYALMT
FMMTGAPLAMVVGCGFPTELATLGIQWHVLAMFAPSFFTGMLISRFGAEKIVAAGLIVLM
ACAIVAHMGIELWNFWAALILLGLGWNFGFIGATAIITSSYRPHEADKVQGFHDIVLFGT
VALSSFSSGKVFTAWGWSVMNLVIWPVAGLCLLLVLSLLLRQRRNVA