Protein Info for Atu1172 in Agrobacterium fabrum C58

Annotation: Putative transcription antitermination protein NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR01951: transcription antitermination factor NusB" amino acids 21 to 158 (138 residues), 135.3 bits, see alignment E=7.5e-44 PF01029: NusB" amino acids 24 to 157 (134 residues), 111.2 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 100% identical to NUSB_AGRFC: Transcription antitermination protein NusB (nusB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 99% identity to agr:AGROH133_05378)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UG69 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Atu1172 Putative transcription antitermination protein NusB (Agrobacterium fabrum C58)
MSDVENGGEPRQPSVKPANQRGAARLAAVQALYQMDVGGTGVMEVVAEYEAHRLGQEVDG
DTYLKADPSWFRSIVSGVVRDQTKIDPLVRSALLEDWPLSRLDATVRAILRAGTFEILER
KDVPVAVIVTEYVEIARAFFEHDEPKLVNAVLDRIAKQVRGEAKR