Protein Info for Atu1158 in Agrobacterium fabrum C58

Annotation: topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 17 to 747 (731 residues), 889.1 bits, see alignment E=1e-271 PF00521: DNA_topoisoIV" amino acids 39 to 473 (435 residues), 464.6 bits, see alignment E=3.2e-143 PF03989: DNA_gyraseA_C" amino acids 559 to 606 (48 residues), 11 bits, see alignment 2.4e-05 amino acids 611 to 650 (40 residues), 9.1 bits, see alignment 9.5e-05 amino acids 657 to 695 (39 residues), 22.1 bits, see alignment 8.4e-09

Best Hits

Swiss-Prot: 82% identical to PARC_RHIME: DNA topoisomerase 4 subunit A (parC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 100% identity to atu:Atu1158)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJF3 at UniProt or InterPro

Protein Sequence (750 amino acids)

>Atu1158 topoisomerase IV subunit A (Agrobacterium fabrum C58)
MGKDLVPPSGGDDNIHPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIIHAMS
EMGIRPNSAFKKCARIVGDVIGKFHPHGDQSVYDALVRLAQDFSQRYPIVDGQGNFGNID
GDGAAAYRYTEARMTDVAALLLEGIGEDAVDFRATYNEEDEEPVVLPGAFPNLLANGASG
IAVGMATSIPPHNAHELCDAALHLIKHPDATVEKLVEFIPGPDLPTGGVIIESRENILDA
YKTGRGGFRVRAKWETEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLIARKLPLLEDVR
DESAEDVRIVLVPKNRTVDATLLMESLFRLSDLESRLPLNMNVLSLGKVPKVMALNEVLS
EWLAHRKDVLVRRSRHRLAAIDRRLEILGGLLIAYLNLDEVIRIIREEDEPKQVMMARWS
LTDNQAEAILNMRLRNLRKLEEFEIRKEHDDLSKEKSEIEGLLASDDKQWQTVAWEIGEV
KKKYAKATEIGRRRTQFADAPDADIEAIQQAMIEKEPVTIVISQKGWIRALKGHMSDTSA
LTFKEGDGPKLAFPAQTTDKLLLLTTGGKAYTLGADKLPGGRGHGEPIRIMVDMENDQDI
LTAFVHDPSRKLLLVSTGGNGFIVAESEMIANTRKGKQIMNVSMPDEAKLAVPVTGDHVA
VVGENRKLLAFPLSQVPEMSRGKGVRLQRYKDGGVVDVKCFALADGLSWSDTAGRAFTKV
GEELREWLADRATVGRTVPKGFPRSGKFGG