Protein Info for Atu1156 in Agrobacterium fabrum C58

Annotation: sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 351 to 383 (33 residues), see Phobius details PF00916: Sulfate_transp" amino acids 16 to 145 (130 residues), 90.7 bits, see alignment E=8.7e-30 amino acids 165 to 356 (192 residues), 104.3 bits, see alignment E=6.2e-34 PF01740: STAS" amino acids 398 to 484 (87 residues), 44.7 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 60% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1156)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZV0 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Atu1156 sulfate permease (Agrobacterium fabrum C58)
MNRFQTYRREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKVGLFASFAIACVSAF
TGGRPGMISAATAATAVLMVTLVKEHGLQYLFAATILMGVLQIAAGFAKLGRVMRFVSRS
VMTGFVNALAILIFMAQLPELIGVPVETYVMIAAGLAIIYLFPLVTKIIPSPLVAIVALT
CVAVFSGMDIRTVGDLGELPSTLPIFALPQVPLTFETLQIIFPYSIALAAVGLLESLLTA
QIVDDMTDTGSNKSQECIGQGTSNIASALIGGMGGCAMIGQSVINVRSGGRGRLSTFVAG
AFLLFLILVLDDLVRIIPMAALVAVMIMVSIGTFSWRSILDLTRNPPSSSIVMLVTVGTV
LATHDLAKGVLAGVLLSGVFFAGKVSKLFHVRPELSADGRERIYRVDGQIFFASTESFIA
AFDFAEEVEAVTIDVTQAHLWDISAVGALDKVVLKFRKTGKRVEVIGVNEASAHMIDRFA
LHDKPDAAAAPLH