Protein Info for Atu1154 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details amino acids 29 to 43 (15 residues), see Phobius details transmembrane" amino acids 28 to 28 (1 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details PF13515: FUSC_2" amino acids 27 to 147 (121 residues), 56.7 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1154)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJF5 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Atu1154 hypothetical protein (Agrobacterium fabrum C58)
MLKTLLDRVRAAFTRALAAALAAAFAFWVAHRWLGHPQPVFAAISALICLSPGIPSHVRQ
GLGLMVGVTVGILVGEVALLVPHDFAEIRLASATFIAMILATLFGLPAVVPIQAGASAML
VLLMGPQIAGFVRFVDVIVGVAVGVVVALVFFRERLKL