Protein Info for Atu1152 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 325 (314 residues), 93.4 bits, see alignment E=2.8e-30 amino acids 207 to 378 (172 residues), 71.1 bits, see alignment E=1.7e-23 PF06779: MFS_4" amino acids 36 to 367 (332 residues), 30.9 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1152)

Predicted SEED Role

"Transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJF6 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Atu1152 MFS permease (Agrobacterium fabrum C58)
MSQIRPLIPLLVTAGILIGGNGLQGTYIALRGLSEGFSASTIGLISAAYSIGFALGCISV
TQLMRRIGHIRTFATMAAVASAASIAMPLVLHPLFWMLMRFVIGIAVACLFAAIESWINA
QVTNSNRARTLSIYRFVDLGSVTLAQYIIPIAGIDGPVVFSLIAMALTLSLVPISIADKS
NPTPPKQIPFNLFAVWRISPLAVVGCVAVGLSMAAFRNMGPIYAEQIGMSVTAIATFMSA
GIIGGVVLQYPLGVYSDRYDRRIIILATTAGSVIVGLFLAFFAGTDEWSNIIGVFVFGAF
ALPLYSLSSAHGNDHAREGEHAMMSAGLLFFWSVGATVGPLLASLLIDQFGPKALFSYTA
AIQIVFIAYTLYRLQVREGVPVEERNWRFRSLLRTSAYFQKLAAPTPPQKADHPKKDEPE
PDPPEKNDP