Protein Info for Atu1149 in Agrobacterium fabrum C58

Annotation: adenylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 158 to 328 (171 residues), 53.3 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 55% identical to CYA2_RHIME: Adenylate cyclase 2 (cya2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to atu:Atu1149)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZV6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu1149 adenylate cyclase (Agrobacterium fabrum C58)
MRKLLPILDYVVLFVAVAGAGVAYAFLEYGGGALIGATYALFACAPILAFERGYILPGLS
RQVSALPTPAYIAVGLIIYAILVFCGFGLGGTILWLSGIFPGTWKRAVHAEVQTLIFTLI
VCGIIVFIMRVRELLGRDIFIDLILGRYRRPVSEDRVFIFIDLVGSTSFAETHGDLKAQE
FLGEIFASYAAPVRRHGGVIDDYIGDAAIITWPYHMAIRRAACVRCVFDIQATMEEKRDM
WLSRFGEVPRLRFAIHGGPVITAEIGVDHHKITYFGDTVNTTSRLESLSKMLGHPVLISA
DLAHQLVLPKGVRSEYLGEHAVKGRGQTLGVCTLSQYQAPAA