Protein Info for Atu1137 in Agrobacterium fabrum C58

Annotation: NTP pyrophosphohydrolase, MutT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 19 to 198 (180 residues), 148 bits, E=1.2e-47
• PF00293: NUDIX
  • amino acids 57 to 168 (112 residues), 40.2 bits, E=1.6e-14

Best Hits

Swiss-Prot: 45% identical to NUDK_PECAS: GDP-mannose pyrophosphatase NudK (nudK) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1137)

MetaCyc: 43% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

See Q7CZW6 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Atu1137 NTP pyrophosphohydrolase, MutT family (Agrobacterium fabrum C58)
MTQTQAKNVPADIDSGRIRLVEKETVWKGFVHMQKLIFDQRMPDGRTMRIVREVHDHGSA
AAILLYDVKRDSVVMVRQFRPAAFVNGDQSFMIEVPAGLLDDDDAADAIRREAMEESGYA
VEKVEYLFDMYASPGTLTEKVSLFVARIDLDVQAGNGGGLEDEGEDLEVLTYGLDEAFAM
IASGEITDSKTIILLQWAMLNRDRLLSRA