Protein Info for Atu1130 in Agrobacterium fabrum C58

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00106: adh_short" amino acids 14 to 195 (182 residues), 115 bits, see alignment E=4.8e-37 PF08659: KR" amino acids 15 to 133 (119 residues), 38.7 bits, see alignment E=1.6e-13 PF13561: adh_short_C2" amino acids 20 to 249 (230 residues), 102.6 bits, see alignment E=4e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1130)

MetaCyc: 100% identical to dihydropterin reductase monomer (Agrobacterium fabrum C58)
RXN-23857 [EC: 1.5.1.50]; 1.5.1.50 [EC: 1.5.1.50]; Pteridine reductase. [EC: 1.5.1.50, 1.5.1.33]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33 or 1.5.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZX3 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Atu1130 dehydrogenase (Agrobacterium fabrum C58)
MSKCRSAVKEHIPKTVLITGAARRLGRAIASDLAAHGFAIAVHANESMAQAEEFANEIRQ
KGGRATAVQADLTQSAPTMALVEKAAAALGPIGVVVNNASVFLADTAETPDPAVFDAHFA
VHVRAPSLIAAAFVEQLPAEKSGLIVNIIDQRVLALTPRFYSYTLSKSTLWTATRTMAQS
FAPRVRVNAIGPGPTFKSERQAPQDFQAQIDGLILKRGPAPDEFGRTIRFLYDTPSITGQ
MIALDGGQHLGWETPDVAEIPE