Protein Info for Atu1126 in Agrobacterium fabrum C58
Annotation: molybdopterin converting factor, large subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to MOAE_RHILO: Molybdopterin synthase catalytic subunit (moaE) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to atu:Atu1126)Predicted SEED Role
"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.-.-.-
Use Curated BLAST to search for 2.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CJG6 at UniProt or InterPro
Protein Sequence (155 amino acids)
>Atu1126 molybdopterin converting factor, large subunit (Agrobacterium fabrum C58) MQKVAQPTVRVQAEDFDAADETRLLTQGDRSIGAVVAFTGLCRDDGGTLTALELEHYPGM AEAEITRIAKLAMERFGLLGLTAIHRHGKIATGENIVLVIAASSHRQAAFDGASFVMDYL KTSAPFWKKEHGRDGTTGDWVAAKATDDTARDKWR