Protein Info for Atu1125 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 230 to 268 (39 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 286 (278 residues), 74 bits, see alignment E=5.8e-25

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu1125)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZX8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Atu1125 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MAYFLQQLLNAVPVAALYAVLAFGYAIAFSVTKRADVTYGAIFAFAGQTCLLFADFGWNR
LWLVLPATLALGAGAGLFGGLWAAGLIGRAVMRPLAKASPNAVTVASIGVLIALTESARL
AADTRQLWLPPLLSQPVRFWIEGGFAVTLTPIQMLNTAVFCLLILTGSLYLGRSAFGRRW
KAVSDDAFAASLLGVNASRIFLLSYCAAGLVAAIAGVLATFYYGTMDFGAGLVFGLKVVL
ISAAGGYASPLICGLGAAAIGFAETFWVGYGPVAWRDAAVLALLVGWLIVMRSRVEAA