Protein Info for Atu1103 in Agrobacterium fabrum C58

Annotation: rRNA-adenine N6,N6-dimethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00398: RrnaAD" amino acids 20 to 275 (256 residues), 175.5 bits, see alignment E=6.1e-56 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 20 to 275 (256 residues), 233.3 bits, see alignment E=1.5e-73

Best Hits

Swiss-Prot: 100% identical to RSMA_AGRFC: Ribosomal RNA small subunit methyltransferase A (rsmA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 100% identity to atu:Atu1103)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGD5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu1103 rRNA-adenine N6,N6-dimethyltransferase (Agrobacterium fabrum C58)
MAAIDGLPPLRDVIQRHGLDAKKSLGQNFLFDLNLTQKIARTAGPLDGVTVIEVGPGPGG
LTRAILSLGAKKVIAVERDSRCLPVLAEIEAHYPGRLEVIEGDALKTDFEALVPAGEPVR
IIANLPYNVGTQLLVNWLLPREWPPFWLSMTLMFQKEVGQRIVAEEGDNHYGRLGVLAGW
RTVSEMAFDVPPQAFSPPPKVTSTVVHLLPKDKPLPCDVAKLERVTEAAFGQRRKMLRQS
VKSLGGETLLEKAGIDPTRRAETLSVEEFVTLANCL