Protein Info for Atu1068 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details TIGR00688: protein RarD" amino acids 18 to 269 (252 residues), 179.3 bits, see alignment E=5.1e-57 PF00892: EamA" amino acids 18 to 153 (136 residues), 41.9 bits, see alignment E=5.9e-15

Best Hits

Swiss-Prot: 37% identical to RARD_STREX: Protein RarD (rarD) from Streptomyces exfoliatus

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to atu:Atu1068)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D016 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Atu1068 hypothetical protein (Agrobacterium fabrum C58)
MALDKTLPAQEGGDSARGFAFALSAYLLWGFLPFYMKAVAHISPIEVIVHRVIWSVPIAA
VVLIALGRTAEIRTALRNPKMLAMASLTAALISINWGVYIWSIGAGRALDAALGYFINPL
FSIFLGAVLLKEKLYPAQIAAICLVGLAVAILTWHAGSLPWVSIALTVSWGFYAFFRKTL
PIGATQGFLLEVMLLSIPAVLVMIWLAFSGQAHFMGGNSADTWLLAASGVITAVPLILYG
NGAKLLRLSTIGIMQYIAPTMIFLIAIFIFKEPFDMVRMAAFAMIWVALAIYTGSSLMRL
KR