Protein Info for Atu1063 in Agrobacterium fabrum C58

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 16 to 221 (206 residues), 202.2 bits, E=3.2e-64
• PF02666: PS_Dcarbxylase
  • amino acids 46 to 217 (172 residues), 168.2 bits, E=9.5e-54

Best Hits

Swiss-Prot: 100% identical to PSD_AGRFC: Phosphatidylserine decarboxylase proenzyme (psd) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to atu:Atu1063)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (12/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See Q8UGH4 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Atu1063 phosphatidylserine decarboxylase (Agrobacterium fabrum C58)
MNLFDTIRNTIVPIHKEGYVFVAAFFVASLVLGWIAEPLFWVGLVLTAWCAYFFRDPERV
TPQDDDLIISPADGKVSAVQSVVPPLELELGKEPMVRISVFMNVFNCHVNRAPVRGRIVN
VAYRPGLFLNAEVDKASEDNERNGLVIETSHGKVGVVQIAGMVARRIVCWVKPNEPVDAG
ERFGLIRFGSRLDIFLPAGFEPRVSVGQTAIAGETVLAEFGSAKGPVLSRRG