Protein Info for Atu1058 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details PF02694: UPF0060" amino acids 2 to 107 (106 residues), 105.3 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 100% identical to Y1058_AGRFC: UPF0060 membrane protein Atu1058 (Atu1058) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K09771, hypothetical protein (inferred from 100% identity to atu:Atu1058)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGH9 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Atu1058 hypothetical protein (Agrobacterium fabrum C58)
MKVYLIYVLAAVAEIAGCFSFWAWLKLGKTGWILLPGMVALAAFAWLLTLVATEAAGRAY
AAYGGIYIAASLFWLWGVEGHAPDRWDIAGGVVCLAGTAIILFGPRG