Protein Info for Atu1050 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 24 to 58 (35 residues), 26.9 bits, see alignment 7.1e-10 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 38 bits, see alignment 2.6e-13 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 67.1 bits, see alignment E=2.4e-22 PF21082: MS_channel_3rd" amino acids 188 to 267 (80 residues), 33.4 bits, see alignment E=9.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1050)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJJ5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Atu1050 hypothetical protein (Agrobacterium fabrum C58)
MEQQATDILVASQTAVRQASALAVQYSFSVIGALLLLIIGWLAAAFLQRWAFQGLSRIRG
FDATLAGFFAGGIRYVVLILVIVMVLGQFGVQTASILAALGAAGLAIGLALQGTLQNIAA
GIMLLVLRPFRVGEYIETSTVSGTIIEIGLFATELKTSDGLYRLAPNSTLWNVPITNYSR
FPSRRHELSLTVKNDEDMAAAQDMLMTVVRSESRILLDPAPVTFVDSVTADSATVKLRYW
VRSDNYFVTTRDVTKAMRLAFDERKAEVNAQPA