Protein Info for Atu1040 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 360 (339 residues), 125.7 bits, see alignment E=2.1e-40 PF12832: MFS_1_like" amino acids 40 to 374 (335 residues), 31.4 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1040)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D040 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Atu1040 MFS permease (Agrobacterium fabrum C58)
MFMSQATRQTMPWLIIAAGSLIAVMTFGPRSAMGFFQLPMLADTGWDRSTFGLAMALQNL
FWGLGQPFFGAIADKYGTGRVLVLSGILYAAGLVCMSFGTSPFWLHFGGGVLVGLGIAAG
SFSVILSAFARHVTPQQRSLAFGIGTAAGSAGMFLFAPISQGLISAYGWSDSLVWLAAMM
VLVPLLAWPMRGNSSSGSQSQAQFQQTVGEALKEALGHKSYLLLTTGFFVCGFQVAFITA
HFPAYLGDIGIEPRYAVIAMALIGFFNIIGSLAAGVIAQRYSKPYLLAYIYIARSVVVTA
FLLLPQSPLSVILFASFMGILWLSTVPPTNALVAIMFGTRHLGMLGGVVFLTHQIGSFLG
VWLGGFLYDRFGTYDIVWWLGVGMGIFAAIVHWPIQERPAPRPVMA