Protein Info for Atu1035 in Agrobacterium fabrum C58

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR02191: ribonuclease III" amino acids 16 to 228 (213 residues), 223 bits, see alignment E=1.7e-70 PF14622: Ribonucleas_3_3" amino acids 29 to 148 (120 residues), 93 bits, see alignment E=2.6e-30 PF00636: Ribonuclease_3" amino acids 47 to 137 (91 residues), 74.9 bits, see alignment E=1.2e-24 PF00035: dsrm" amino acids 163 to 227 (65 residues), 48.5 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 100% identical to RNC_AGRFC: Ribonuclease 3 (rnc) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to atu:Atu1035)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGK2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu1035 ribonuclease III (Agrobacterium fabrum C58)
MSKTKPLSADEISRLEALIGYEFKEKARLDRALTHASARSAAAGNYERLEFLGDRVLGLC
VAELLFSTFRNASEGELSVRLNQLVSAESCAAIGDEMGLHNFIRTGSDVKKLTGKAMLNV
RADVVESLIATLYLDGGLEASRKFILKYWQGRATSVDAGRRDAKTELQEWAHARFAATPA
YRVDDRSGPDHDPSFTVTVEIPGVKPETGVERSKRAAEQVAATRLLEREGVWRKSPTGN