Protein Info for Atu1034 in Agrobacterium fabrum C58

Annotation: prokaryotic type I signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF10502: Peptidase_S26" amino acids 13 to 220 (208 residues), 194.9 bits, see alignment E=5e-62 TIGR02227: signal peptidase I" amino acids 16 to 222 (207 residues), 177.1 bits, see alignment E=1.2e-56

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 100% identity to atu:Atu1034)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJK6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Atu1034 prokaryotic type I signal peptidase (Agrobacterium fabrum C58)
MSEKAEKKQNALWENVKVIIQALLLAMVIRTVLFQPFTIPSGSMMPTLLVGDYLFVNKFS
YGYSKYSLPFSPNLFSGRILEFSKPKRGDVVVFRLPPNPEVDYIKRLVGLPGDRVQVTNG
VLFINGQPVPKQPDGTFTSDYRADPGTNVPVFRETLDNGVTYDTLDQSPDSRGDNTREFV
VPEGHYFMMGDNRDNSLDSRFDVGFVPEENLIGRASVIFFSLGNDTPFSRIWEWPANMRW
DRLFKVVG