Protein Info for Atu1027 in Agrobacterium fabrum C58

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF11563: Protoglobin" amino acids 8 to 166 (159 residues), 145 bits, see alignment E=2e-46 PF00015: MCPsignal" amino acids 298 to 452 (155 residues), 169.3 bits, see alignment E=7.3e-54

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to atu:Atu1027)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJK8 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Atu1027 methyl-accepting chemotaxis protein (Agrobacterium fabrum C58)
MHGQAKTDRQLDERLNFLGLGHGERQNLSDMKGVITGSLDASLDRFYTKVRAVPETAKFF
SSEAHIHHAKSMQLKHWSRIASGTFNEDYTNAVTAIGRTHARLGLEPRWYIGGYALMLDG
IVKAVIESELKGLFMEKKAKKVKDALSATIKAALLDMDYSISVYLDVLATERQKVEAEQA
QMKKEQDHVLELLNNALDRLANGDLTSSIAEKTAPQFEGLIANFNAAVGNLSGAFAQIVE
EANKISGNTRELTAATDDMARRTEQQAAALEETAAAVEEITTISKLSAQRSEEAKAIVES
SAVEAARSRDVVTDAVKAMGAIEESSQKITQIISVIDEISFQTNLLALNAGVEAARAGEA
GKGFAVVAQEVRELAQRSANAAKEIKTLIAKSSEDVTQGVSLVNKTGESLNTIGNKVDHI
KDHITSLTKAAQEQSVGIQEISAAINSMDNLTQKNAAMVEETNAATHNLSDVSANLAALV
SRFSVSATRAHVERTYRAA