Protein Info for Atu0996 in Agrobacterium fabrum C58

Annotation: zinc-binding dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 152 to 166 (15 residues), see Phobius details TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 338 (337 residues), 557.4 bits, see alignment E=6.6e-172 PF08240: ADH_N" amino acids 31 to 89 (59 residues), 46.2 bits, see alignment E=7e-16 PF00107: ADH_zinc_N" amino acids 161 to 247 (87 residues), 42.8 bits, see alignment E=7.6e-15 PF13602: ADH_zinc_N_2" amino acids 194 to 335 (142 residues), 53 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0996)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJL7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Atu0996 zinc-binding dehydrogenase (Agrobacterium fabrum C58)
MRAIGYKTSQPITAADALIDIDLAQPEAKGHDILVEVKAVSVNPVDTKVRRNQSPENGAT
RVLGFDASGVVKAVGDRVSLFKPGDEVFYAGVINRPGSNSEFHLVDERIVGAKPKSLNFE
EAAALPLTAITAYETLFDRLRVKEPVPGAANAVLVIGGAGGVGSIAIQLLRALTDLTVIA
TASRPETMEWVKELGAHHVVDHGKPIAPQVEALGLGAPGFVFSTTHSDIHAADSVATIAP
QGRFALIDDPAGGFDVMAFKRKCVSIHWEMMFARAVFETPDMIEQHKLLNHVAELVDAGK
IRTTLTEVFGTINAANLIKAHALIESNTARGKIVLSGF